Recombinant Human PXMP2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens peroxisomal membrane protein 2 (PXMP2) (NM_018663).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NR77
Entry Name PXMP2_HUMAN
Gene Names PXMP2 PMP22
Alternative Gene Names PMP22
Alternative Protein Names Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 195
Molecular Weight(Da) 22253
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK
Background
Function FUNCTION: Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.
Pathway
Protein Families Peroxisomal membrane protein PXMP2/4 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8030845

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PXMP2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.